PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.094440.1
Common NameCsa_4G017090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family FAR1
Protein Properties Length: 251aa    MW: 28655.1 Da    PI: 6.7259
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.094440.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR192.65.1e-2986173291
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     fYn+YA++vGF +r+sk ++s+r+g+ + r +vC+keg+r ++k++  k  r+raetr+gC+a++ v+k ++gkw+vtk+++eH+H+l+p
  Cucsa.094440.1  86 FYNSYATRVGFVIRVSKLSRSRRDGTAIGRALVCNKEGYRMPDKRE--KIVRQRAETRVGCRAMILVRKVNSGKWVVTKFVKEHTHPLSP 173
                     ******************************************9988..9**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.4E-2686173IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MEFGVDGDSE VVGNSTLVED SKPLDENETG VSSIERIFDQ DQDEKIIQDS TGRNAILDSV  60
PGLPIVQADE PYVGQEFENE AAAHAFYNSY ATRVGFVIRV SKLSRSRRDG TAIGRALVCN  120
KEGYRMPDKR EKIVRQRAET RVGCRAMILV RKVNSGKWVV TKFVKEHTHP LSPGKARRDC  180
IYDQYPNEHD KIRELSQQLA IEKKRSATYK RHLEVIFEYI EEHNDSLSRK IQHIVDNVKE  240
LESVEQQNHR *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818740.0LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004152087.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 6
TrEMBLA0A0A0KZ370.0A0A0A0KZ37_CUCSA; Uncharacterized protein
STRINGGLYMA15G03440.11e-135(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24533072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-113FAR1 family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]